PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s743291g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Nin-like
Protein Properties Length: 841aa    MW: 92223.6 Da    PI: 5.9314
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s743291g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.31.5e-28475525252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+ sle+l++yFs+++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki++l
  PDK_30s743291g002 475 EKSFSLEVLQQYFSGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKL 525
                        8999*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.575461545IPR003035RWP-RK domain
PfamPF020422.4E-26478525IPR003035RWP-RK domain
SuperFamilySSF542771.11E-22739832No hitNo description
SMARTSM006662.6E-25746828IPR000270PB1 domain
PfamPF005648.5E-16746827IPR000270PB1 domain
PROSITE profilePS5174520.353746828IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.6E-25746827No hitNo description
CDDcd064076.90E-36747827No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MKENSDASCV IKERMMQALR YFKESTDQHV LVQVWAPVKK GDQCFLTTSG QPFVLDPRST  60
GLLQYRTVSL TYIFSVDEDS GGYLGLPGRV YRYRLPEWTP SVQYYSSKEY LRLAHALNYN  120
VQGTLALPVF EPSDQSCVGV VELVMTSQKI NYSHEVDIVC KALQTVNLKS SEILDHPNIQ  180
ISNEGRQAAL AEILEILTVV CEAQKLPLAQ TWVPCKHGTI LTHGGGLKKN CSSFDGSCMG  240
QVCMSATDIA FYVIDAHMWG FREACVEHHL QIGQGVAGRA FALRRPCFAE DVAKFCKSEY  300
PLVHYAWMFG LVGCLAICLQ STHSGDDDYI VEFFLPQDCK NPVEQRALLD SISTLMKNCF  360
RSLKVVSDLD LQEGISFEVI DMFAYENHGC EPKHICSQNC DAYVHTSPET HIPEGHDDSQ  420
NEGNATSDAL KQHLPPHANA ERASNIHFVS GIGGASSSLL SNKNNGAPEK SGKAEKSFSL  480
EVLQQYFSGS LKDAAKSLGV CPTTMKRICR QHGISRWPSR KINKLNRSLS KLKRVMESVQ  540
GAEGAFNLSS LACPLPVTVG SFSWSVNLDE SKESKGAVKD NVSSPHKTPE RDDQHDKLLA  600
QLELGHGLPS PKAEPGKDSP CSKTKSSSEG SVETPASQGS CHGCPVNKTF WDNASPLSNL  660
KQGTVVTDPS EFTLQYAGGP NLPSICLMPG VNVAEPQPRL SRMLIEDSGS SKDLKNLCSD  720
AGEGCEDEHA MAADPLPPMV MHEMKTVTIK ASYKEDIIRF RLQITAGISA LKDEVAKRLK  780
LEVGTFDIKY LDDDHEWVML ACDADLEECI EISGLSASHV IRLSVHDIVP NLGSSCESSG  840
D
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008806288.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLM0SHP00.0M0SHP0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P25240_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7